Welcome to the GoFuckYourself.com - Adult Webmaster Forum forums.

You are currently viewing our boards as a guest which gives you limited access to view most discussions and access our other features. By joining our free community you will have access to post topics, communicate privately with other members (PM), respond to polls, upload content and access many other special features. Registration is fast, simple and absolutely free so please, join our community today!

If you have any problems with the registration process or your account login, please contact us.

Post New Thread Reply

Register GFY Rules Calendar Mark Forums Read
Go Back   GoFuckYourself.com - Adult Webmaster Forum > >
Discuss what's fucking going on, and which programs are best and worst. One-time "program" announcements from "established" webmasters are allowed.

 
Thread Tools
Old 02-22-2007, 12:58 AM   #1
italianmick69
Confirmed User
 
Join Date: Feb 2007
Posts: 125
Please Appraise My New Domain Name Slamming.org

Slamming.org

I will be putting this on sedo I believe, unless people are interested here..
italianmick69 is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 02-22-2007, 12:59 AM   #2
sharp
Confirmed User
 
Join Date: Jan 2003
Posts: 7,006
nothing special.
Maybe mid XXX
sharp is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 02-22-2007, 01:03 AM   #3
italianmick69
Confirmed User
 
Join Date: Feb 2007
Posts: 125
italianmick69 is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 02-22-2007, 01:12 AM   #4
Jon Clark - BANNED FOR LIFE
North Coast Pimp
 
Join Date: Dec 2005
Location: 304-534-757
Posts: 9,395
Only good for a organization that likes to slam stuff around... other then that useless!
Jon Clark - BANNED FOR LIFE is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 02-22-2007, 01:15 AM   #5
italianmick69
Confirmed User
 
Join Date: Feb 2007
Posts: 125
yeah john clark you are smart......its a great domain name for branding I guarantee I can get XXX-Low XXXX


do you know how many people say slamming in hip-hop?
or wrestling?

also can be used for a porn site like slamming that ass...


your opinion does not count as you have no clue how good of a domain name it really is, not saying its the best, but its good especially for the money I paid for it.
italianmick69 is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 02-22-2007, 01:20 AM   #6
italianmick69
Confirmed User
 
Join Date: Feb 2007
Posts: 125
I thought this was pretty funny...from overture

Count Search Term
2941 slamming
204 leech slamming
178 pussy slamming
142 slamming pervert
131 ass slamming
73 slamming door
53 chem slamming
51 pervert pig sex slamming
46 cock slamming
43 anal slamming
40 door our screen slamming song
35 cervix slamming
32 slamming gay
30 slamming spam
29 phone slamming
28 slamming teen
italianmick69 is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 02-22-2007, 01:23 AM   #7
sharp
Confirmed User
 
Join Date: Jan 2003
Posts: 7,006
Quote:
Originally Posted by italianmick69 View Post
yeah john clark you are smart......its a great domain name for branding I guarantee I can get XXX-Low XXXX


do you know how many people say slamming in hip-hop?
or wrestling?

also can be used for a porn site like slamming that ass...


your opinion does not count as you have no clue how good of a domain name it really is, not saying its the best, but its good especially for the money I paid for it.

jeeze, calm down noob. You asked for people's opinions. If you wanted people to tell you what you wanted to hear, shoulda said so
sharp is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 02-22-2007, 01:29 AM   #8
bobby666
boots are my religion
 
bobby666's Avatar
 
Join Date: Nov 2005
Location: Heart of europe
Posts: 21,765
__________________
bobby666 is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 02-22-2007, 01:45 AM   #9
SabrinaDeep
Confirmed User
 
Join Date: Aug 2006
Posts: 304
Quote:
Originally Posted by italianmick69 View Post
your opinion does not count as you have no clue how good of a domain name it really is, not saying its the best, but its good especially for the money I paid for it.
If his opinion does not count, why did you ask for an appraisal?

200k dollars!

I guess my opinion counts?

Unfortunately, if you sell it i'm afraid that Jon Clark figure is gonna be more realistic than mine.

Look at slamming.com and slamming.net: they don't look like there were many craving for them, given the purpose they are used for. That should tell you a lot. Plus the keyword "slammin" searched 3000 times in a month might mean not more than 200 visitors a month. I say that it might, because probably a website about tennis called letsplaytenniswhenwefeellike.com with a page called slamming.html and the keyword "grand slam" showing in the content has more chances to be on top of SE than the website called slamming.org.

I've been offered 1000 bucks for chemistries.org...should tell you all. It'll change, but right now this is the market. I'd suggest you to keep it and wait patiently.

My 2 cents
__________________
Fan$talker - Pornstars who fuck their fans
ICQ# 304-624-368
SabrinaDeep is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 02-22-2007, 02:20 AM   #10
Mike Semen
Confirmed User
 
Mike Semen's Avatar
 
Join Date: Dec 2001
Location: London Town
Posts: 2,924
Quote:
Originally Posted by italianmick69 View Post
I thought this was pretty funny...from overture

Count Search Term

51 pervert pig sex slamming
WTF!!!!!

Oh and its a not bad dot org. high $XX to low $XXX.
__________________
ICQ 1454 81 522 |
Mike Semen is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 02-22-2007, 04:16 AM   #11
dig420
Confirmed User
 
Industry Role:
Join Date: May 2001
Posts: 9,240
lol i'm pretty sure I own slamming.com...

any offers?
dig420 is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 02-22-2007, 04:17 AM   #12
dig420
Confirmed User
 
Industry Role:
Join Date: May 2001
Posts: 9,240
yep it's mine
dig420 is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Post New Thread Reply
Go Back   GoFuckYourself.com - Adult Webmaster Forum > >

Bookmarks
Thread Tools



Advertising inquiries - marketing at gfy dot com

Contact Admin - Advertise - GFY Rules - Top

©2000-, AI Media Network Inc



Powered by vBulletin
Copyright © 2000- Jelsoft Enterprises Limited.